PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AMDW01030201.1_FGP001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 63aa    MW: 7688.9 Da    PI: 10.4678
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AMDW01030201.1_FGP001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.73.1e-191660147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                           r rW++eE+e+++da  ++G + Wk+I +++g ++t  q++s+ qky
  AMDW01030201.1_FGP001 16 RERWSEEEHERFLDALIMYGRD-WKKIEEHVG-TKTTIQIRSHAQKY 60
                           78******************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.93E-191063IPR009057Homeodomain-like
PROSITE profilePS5129421.021163IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-91362IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-191463IPR006447Myb domain, plants
SMARTSM007171.3E-121563IPR001005SANT/Myb domain
PfamPF002497.6E-161660IPR001005SANT/Myb domain
CDDcd001671.23E-81861No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MPGKKARKPY TITKPRERWS EEEHERFLDA LIMYGRDWKK IEEHVGTKTT IQIRSHAQKY  60
FLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1069691e-101AK106969.1 Oryza sativa Japonica Group cDNA clone:002-119-G02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646001.12e-39PREDICTED: protein REVEILLE 8
SwissprotQ6R0H17e-28LHY_ARATH; Protein LHY
TrEMBLA0A0E0JE906e-40A0A0E0JE90_ORYPU; Uncharacterized protein
STRINGORGLA01G0032300.13e-39(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.44e-29MYB_related family protein